PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG791600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 852aa    MW: 93415.6 Da    PI: 6.0589
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG791600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.2e-182785357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         k  ++t+eq+e+Le+l+  +++ps ++r++L +++    +++ +q+kvWFqNrR ++k+
  Pavir.9NG791600.1.p 27 KYVRYTPEQVEVLERLYIDCPKPSSSRRQQLLRECpilaNIEPKQIKVWFQNRRCRDKQ 85
                         5678****************************************************996 PP

2START154.96.7e-491653732205
                          HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT..E CS
                START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg..g 89 
                          +aee+ +e+++ka+ ++  Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++++ e+l d++  W +++++ e+      g  g
  Pavir.9NG791600.1.p 165 IAEETFTEFLSKATGTAIDWVQMPGMKPGPDSVGIVAISHGCRGVAARACGLVNLEPTKVIEILKDRP-SWFRDCRSLEVFTMFPAGngG 253
                          789999****************************************************7777777777.***********999999999* PP

                          EEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
                START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                          +++l +++++a+++lvp Rdf+++Ry+ + ++g+++++++S++     p+    +++vRae+lpSg+l++p+++g+s v++v+h dl++r
  Pavir.9NG791600.1.p 254 TIELVYMQMYAPTTLVPaRDFWTLRYTTTTEDGSLMVCERSLSGSGGGPNaasAHQFVRAEMLPSGYLVRPCEGGGSIVHIVDHLDLEAR 343
                          ********************************************99999999999*********************************** PP

                          XXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 176 lphwllrslvksglaegaktwvatlqrqce 205
                          +++++lr+l++s+++ ++k+++ +l+++++
  Pavir.9NG791600.1.p 344 SVPEVLRPLYESSRVVAQKMTTVALRHLRQ 373
                          *********************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-17785IPR009057Homeodomain-like
PROSITE profilePS5007115.2892286IPR001356Homeobox domain
SMARTSM003895.3E-152490IPR001356Homeobox domain
SuperFamilySSF466899.84E-162688IPR009057Homeodomain-like
CDDcd000861.29E-152787No hitNo description
PfamPF000466.4E-162885IPR001356Homeobox domain
CDDcd146863.83E-679118No hitNo description
PROSITE profilePS5084826.515155383IPR002913START domain
CDDcd088751.26E-73159375No hitNo description
SuperFamilySSF559612.47E-35164376No hitNo description
Gene3DG3DSA:3.30.530.201.2E-20164347IPR023393START-like domain
SMARTSM002347.6E-37164374IPR002913START domain
PfamPF018521.4E-46165373IPR002913START domain
PfamPF086707.7E-43697824IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 852 aa     Download sequence    Send to blast
MAAAVAMPGG SSDSGGFDKI PGMDSGKYVR YTPEQVEVLE RLYIDCPKPS SSRRQQLLRE  60
CPILANIEPK QIKVWFQNRR CRDKQRKESS RLQAVNRKLT AMNKLLMEEN ERLQKQVSQL  120
VHENAHMRQQ LQNTSLANDT SCESNVTTPP NPIRDASNPS GLLSIAEETF TEFLSKATGT  180
AIDWVQMPGM KPGPDSVGIV AISHGCRGVA ARACGLVNLE PTKVIEILKD RPSWFRDCRS  240
LEVFTMFPAG NGGTIELVYM QMYAPTTLVP ARDFWTLRYT TTTEDGSLMV CERSLSGSGG  300
GPNAASAHQF VRAEMLPSGY LVRPCEGGGS IVHIVDHLDL EARSVPEVLR PLYESSRVVA  360
QKMTTVALRH LRQIAQETSG EVVYALGRQP AVLRTFSQRL SRGFNDAISG FNDDGWSIMG  420
GDGIEDVIVA CNSTKKIRNS SSVGITFGAP GGIICAKASM LLQSVPPAVL VRFLREHRSE  480
WADYNIDAYL ASSLKASVCS LPGLRPMRFS GGQMIMPLAH TVENEEILEV VRLEGQSLTH  540
DEALLSRDIH LLQLCTGIDE KSVGSSFQLV FAPIDEHFPD DAPLISSGFR VIPLDMKTDG  600
VSSGRTLDLA SSLDVGSAAP QASGDASPDD CNLRSVLTIA FQFPYEMHLQ DSVATMARQY  660
VRSVVSAVQR VSMAISPSQS GLNAGQRMLS GFPEAGTLAR WVCQSYHYHL GVELLNQSDE  720
AGEALLKMLW HHPDAILCCS FKEKPMFTFA NKAGLDMLET SLVALQDLTL DKIFDESGRK  780
ALFSDISKLM EQGYVYLPSG VCMSGMGRHV SFDQAVAWKV LDGTCPELQI LQVNTISSWD  840
WSKDWEKGWL A*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.76350.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865260.0DQ286526.1 Zea mays rolled leaf 2 (rld2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468669.10.0hypothetical protein SORBIDRAFT_01g050000
SwissprotA2XBL90.0HOX10_ORYSI; Homeobox-leucine zipper protein HOX10
TrEMBLC5WMP70.0C5WMP7_SORBI; Putative uncharacterized protein Sb01g050000
STRINGSb01g050000.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein